PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G1504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 294aa    MW: 33422.1 Da    PI: 10.3905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G1504genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.23e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd+ll  +++++G g+W + +++ g+ R++k+c++rw +yl
      Gh_A12G1504 16 RGPWTAEEDKLLTAYIQKHGYGSWGSLPHKAGLERCGKSCRLRWINYL 63
                     89********************************************97 PP

2Myb_DNA-binding54.33.1e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ ++++++ lG++ W++Ia++++ +Rt++++k++w+++l
      Gh_A12G1504  69 RGKFSLEEEQTIIQLHAFLGNR-WSAIAARLP-KRTDNEIKNHWNTHL 114
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0791163IPR017930Myb domain
SuperFamilySSF466893.11E-3013110IPR009057Homeodomain-like
SMARTSM007175.1E-121565IPR001005SANT/Myb domain
PfamPF002491.7E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-231770IPR009057Homeodomain-like
CDDcd001671.81E-91863No hitNo description
PROSITE profilePS5129425.68864118IPR017930Myb domain
SMARTSM007171.6E-1668116IPR001005SANT/Myb domain
PfamPF002493.4E-1669114IPR001005SANT/Myb domain
CDDcd001674.79E-1171114No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2671119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MRPPSPNRKK EVRLKRGPWT AEEDKLLTAY IQKHGYGSWG SLPHKAGLER CGKSCRLRWI  60
NYLRPDIKRG KFSLEEEQTI IQLHAFLGNR WSAIAARLPK RTDNEIKNHW NTHLKKRLIK  120
MGIDPMTHKP STTPSPKNGS NLSHMAQWES ARLQAEARLV RESKQVVPNL TTRPTRRSQL  180
TRSSPRCLDI LKAWQGVVAG MFVFSTQDPR SLTTSTLRFP SAGWGEAEEW RGQGMKGSSD  240
ADDAWFEEDS VILHSLPIEN IMEGLSDAFI LNSWMGVDKS TDENIVKENG QLLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.103605e-73boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461875e-73
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362834e-70AF336283.1 Gossypium hirsutum GHMYB25 (ghmyb25) mRNA, complete cds.
GenBankEU8264654e-70EU826465.1 Gossypium hirsutum cultivar Acala Maxxa R2R3 MYB transcription factor gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438546.10.0PREDICTED: transcription repressor MYB6-like isoform X1
TrEMBLA0A0B0MMZ90.0A0A0B0MMZ9_G
STRINGPOPTR_0008s08920.11e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2818533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.19e-84myb domain protein 106